Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

4,231 – 4,245 of 115,743 results

4,231

R&D Systems™ Recombinant Human Osteoadherin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

4,232

R&D Systems™ Recombinant Human Siglec-2/CD22 His-tag Avi-tag Protein

Biotinylated

Pricing & Availability

4,233

Novus Biologicals™ EIF1AX Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	EIF1AX
Molecular Weight (g/mol)	18.6kDa
Gene ID (Entrez)	1964
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 40% glycerol, 5mM DTT, 200mM NaCl
Immunogen	MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

4,234

R&D Systems™ Recombinant Mouse LIFR alpha Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,235

Novus Biologicals™ Recombinant Human Syntrophin alpha 1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

4,236

Novus Biologicals™ RPE Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	RPE
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

4,237

Novus Biologicals™ Recombinant Human COMMD6 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	Acrg, Acrg Embryonic Lethality Minimal Region Ortholog, COMM Domain Containing 6, COMM Domain-Containing Protein 6
Common Name	COMMD6
Molecular Weight (g/mol)	TMW: 12kDa
Gene ID (Entrez)	170622
Formulation	20mM Tris-HCl buffer (pH7.0) containing 20% glycerol 0.15M NaCl, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,238

R&D Systems™ Recombinant Human NTB-A/SLAMF6 Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,239

Novus Biologicals™ PIN/DLC8 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	PIN/DLC8
Molecular Weight (g/mol)	12.5kDa
Gene ID (Entrez)	8655
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 1mM DTT, 10% glycerol
Immunogen	DYNLL1, 1-89 aa. MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

4,240

Novus Biologicals™ Translin Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	Translin
Molecular Weight (g/mol)	26.1kDa
Gene ID (Entrez)	7247
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol. 100mM NaCl
Immunogen	TSN, 1- 228 aa. Sequence: MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGFNKETAAACVEK
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

4,241

R&D Systems™ Recombinant SARS-CoV-2 B.1.1.7 Spike S1 His-tag Protein

Alpha Variant (UK)

Pricing & Availability

4,242

Novus Biologicals™ Recombinant Human Dnmt2 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

4,243

R&D Systems™ Recombinant Human Neurolysin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,244

Novus Biologicals™ FKBPL Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	FKBPL
Molecular Weight (g/mol)	39.2kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 2mM DTT, 100mM NaCl
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,245

Novus Biologicals™ SHMT1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

Prev
1
...
281
282
283
284
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ EIF1AX Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Syntrophin alpha 1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ RPE Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human COMMD6 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PIN/DLC8 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Translin Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Dnmt2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ FKBPL Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ SHMT1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ EIF1AX Protein

Novus Biologicals™ Recombinant Human Syntrophin alpha 1 His Protein

Novus Biologicals™ RPE Protein

Novus Biologicals™ Recombinant Human COMMD6 His Protein

Novus Biologicals™ PIN/DLC8 Protein

Novus Biologicals™ Translin Protein

Novus Biologicals™ Recombinant Human Dnmt2 His Protein

Novus Biologicals™ FKBPL Protein

Novus Biologicals™ SHMT1 Protein